Incorporation of antimicrobial compounds in mesoporous silica film monolith.

Abstract

Incorporation of the antimicrobial peptide LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieved without greatly affecting the structure of the mesoporous silica. The modified mesoporous silica released LL-37 and chlorhexidine slowly, reaching maximum release after about 200 h. The release rate could also be controlled through incorporation of SH groups in the pore walls, adding to pore hydrophobicity and reducing the release rate by about 50% compared to the unmodified mesoporous silica. Mesoporous silica containing either LL-37 or chlorhexidine displayed potent bactericidal properties against both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli. While chlorhexidine-loaded mesoporous silica displayed an accompanying high toxicity, as judged from hemolysis, LDH release, and MTT assay, the corresponding material containing LL-37 showed very low toxicity by all these assays, comparable to that observed for mesoporous silica in the absence of antibacterial drug, as well as to the negative controls in the respective assays. Mesoporous silica containing LL-37 therefore holds potential as an implantable material or a surface coating for such materials, as it combines potent bactericidal action with low toxicity, important features for controlling implant-related infections, e.g., for multi-resistant pathogens or for cases where access to the infection site of systemically administered antibiotics is limited due to collagen capsule formation or other factors.

• Authors: Isabel Izquierdo-Barba, María Vallet-Regí, Natalia Kupferschmidt, Osamu Terasaki, Artur Schmidtchen, Martin Malmsten
• Journal: Biomaterials (Biomaterials) Vol. 30 Issue 29 Pg. 5729-36 (Oct 2009) ISSN: 1878-5905 [Electronic] Netherlands
• PMID: 19628277 (Publication Type: Journal Article, Research Support, Non-U.S. Gov't)

Chemical References

• Anti-Bacterial Agents
• Drug Carriers
• Membranes, Artificial
• Silicon Dioxide

Topics

• Adsorption
• Anti-Bacterial Agents (administration & dosage, chemistry)
• Drug Carriers (chemistry)
• Drug Compounding (methods)
• Materials Testing
• Membranes, Artificial
• Porosity
• Silicon Dioxide (chemistry)